Glyma15g13220 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g13220

Feature Type:	gene_model
Chromosome:	Gm15
Start:	9839558
stop:	9844758
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g13220

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04760	AT	Annotation by Michelle Graham. TAIR10: vesicle-associated membrane protein 726 \| chr1:1334760-1336070 FORWARD LENGTH=220	SoyBase	E_val: 4.00E-127	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0048451	GO-bp	Annotation by Michelle Graham. GO Biological Process: petal formation	SoyBase	N/A	ISS
GO:0048453	GO-bp	Annotation by Michelle Graham. GO Biological Process: sepal formation	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG0859	KOG	Synaptobrevin/VAMP-like protein	JGI		ISS
PTHR21136	Panther	SNARE PROTEINS	JGI		ISS
PTHR21136:SF46	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00957	PFAM	Synaptobrevin	JGI		ISS
UniRef100_B9SVX6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vesicle-associated membrane protein, putative n=1 Tax=Ricinus communis RepID=B9SVX6_RICCO	SoyBase	E_val: 2.00E-138	ISS
UniRef100_I1MFZ3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MFZ3_SOYBN	SoyBase	E_val: 3.00E-163	ISS

Expression Patterns of Glyma15g13220

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g13220

Paralog	Evidence	Comments
Glyma09g02310	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g13220 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g126200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g13220

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g13220

Limit To All Plant Sequences

>Glyma15g13220.1   sequence type=CDS   gene model=Glyma15g13220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGCAGAAGTCTCTGATCTACGCGTTCGTGTCGCGGGGAACTGTGATTCTCGCGGAGTACACGGAATTCAGCGGAAACTTCAACTCCATCGCCTTCCAGTGCCTTCAGAAGCTCCCTGCCACCAACAACAAGTTCACCTACAACTGCGACGCACACACCTTCAATTACCTCGTCGACAATGGCTACACATATTGTGTTGTTGCAGATGAATCAATTGGAAGACAGTTACCCATGGCTTTTCTAGAGCGTGTCAAAGATGAATTTGTGGCAAAATATGGTGGTGGAAAGGCTGCCACTGCTCCTGTGAACAGCCTTAACAAGGAATTTGGGCCAAAGTTGAGGGAACATATGCAGTACTGTGTTGATCATCCTGAAGAGATAAGCAAGCTTGCAAAGGTGAAAGCTCAAGTTTCTGAAGTTAAGGGTGTCATGATGGAGAATATTGAAAAGGTTCTAGACAGGGGTGACAAGATAGAGCTTCTGGTGGACAAGACTGAGAACCTTCATAACCAGGCACAAGATTTCAGAACTTCTGGAACCAGAATCCGTCGAAAAATGTGGCTGCAAAACATGAAGATTAAGCTGATTGTATTGGGAATATTGATAGCACTTATCCTGATAATAGTCCTATCTGTATGTCGTGGGTTCAACTGTGGAAAATAA

Predicted protein sequences of Glyma15g13220

Limit To All Plant Sequences

>Glyma15g13220.1   sequence type=predicted peptide   gene model=Glyma15g13220   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQKSLIYAFVSRGTVILAEYTEFSGNFNSIAFQCLQKLPATNNKFTYNCDAHTFNYLVDNGYTYCVVADESIGRQLPMAFLERVKDEFVAKYGGGKAATAPVNSLNKEFGPKLREHMQYCVDHPEEISKLAKVKAQVSEVKGVMMENIEKVLDRGDKIELLVDKTENLHNQAQDFRTSGTRIRRKMWLQNMKIKLIVLGILIALILIIVLSVCRGFNCGK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain